Skip to main content

Advertisement

Table 2 Centrin 2 amino acid sequence comparison among zebrafish, Xenopus and mousea

From: Centrosomes in the zebrafish (Danio rerio): a review including the related basal body

1 MASNYKKPSLGVTTQRKKPVPKPELTEEQKQEIREAFDLFDTDGAGTIDVKELKVAMRAL 60 XENTR
1 MASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRAL 60 MOUSE
1 MASGFRK-SSASANQRKKAGPKPELTEEQKQEIKEAFDLFDTDGSGTIDVKELKVAMRAL 59 DANRE
61 GFEPKKEEIKKMIADIDKEGTGKISFGDFMSAMTQKMAEKDSKEEIMKAFRLFDDDETGK 120 XENTR
61 GFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK 120 MOUSE
60 GFEPKKEEIKKMIADIDKEGSGVIGFSDFLSMMTQKMSEKDSKEEILKAFRLFDDDCTGK 119 DANRE
121 ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY- 172 XENTR
121 ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY- 172 MOUSE
120 ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEINEQEFLRIMKKTNLYG 172 DANRE
  1. aXenopus centrin 2 (Q28HC5_XENTR), mouse centrin 2 (CETN2_MOUSE) and zebrafish centrin 2 (B1P0R9_DANRE). Numbers refer to primary structure.